Structure of PDB 8svf Chain E

Receptor sequence
>8svfE (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB8svf Structural basis of histone H2A lysine 119 deubiquitination by Polycomb repressive deubiquitinase BAP1/ASXL1.
ChainE
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E Y41 V46 K64 L65 R69 Y2 V7 K25 L26 R30
BS02 dna E Y41 R42 R72 F84 Q85 R116 V117 T118 Y2 R3 R33 F45 Q46 R77 V78 T79
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8svf, PDBe:8svf, PDBj:8svf
PDBsum8svf
PubMed37556531
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]