Structure of PDB 8rjw Chain E

Receptor sequence
>8rjwE (length=171) Species: 9606 (Homo sapiens) [Search protein sequence]
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAQKVCYIEGHRVINLANE
MFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYG
VSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNK
LPVDLTKAKRQDLEPSVEEAR
3D structure
PDB8rjw Mechanism of single-stranded DNA annealing by RAD52-RPA complex
ChainE
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R55 V63 Y65 K141 E145 T148 K152 R153 R31 V36 Y38 K114 E118 T121 K125 R126
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0000730 DNA recombinase assembly
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0006310 DNA recombination
GO:0006312 mitotic recombination
GO:0010792 DNA double-strand break processing involved in repair via single-strand annealing
GO:0034599 cellular response to oxidative stress
GO:0045002 double-strand break repair via single-strand annealing
GO:2000819 regulation of nucleotide-excision repair
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0032991 protein-containing complex
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rjw, PDBe:8rjw, PDBj:8rjw
PDBsum8rjw
PubMed38658755
UniProtP43351|RAD52_HUMAN DNA repair protein RAD52 homolog (Gene Name=RAD52)

[Back to BioLiP]