Structure of PDB 8rjb Chain E

Receptor sequence

>8rjbE (length=223) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

KGKPHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYAALATVTKPVGGGTR
VVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTG
RHRGKRVVFLKQLSSGLLLVTGPLSLNRVPLRRTHQKFVIATSTKIDISG
VKIPKHLTDAYFKKKKLRKPEKEKYEITEQRKVDQKAVDSQILPKIKAVP
QLQGYLRSVFALTNGVYPHKLVF

3D structure

PDB

8rjb UCSF ChimeraX: Meeting modern challenges in visualization and analysis.

Chain

Resolution

2.69243 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	G42 H45 C46 S47 R48 N49 R54 R58 S60 R61 S62 M64 Y65 S66 R67 K68 A69 Y71 K72 R73 Y75 A77 A93 T94 K97 P98 V99 G100 R108 K111 K114 M115 P116 R117 Y118 V124 P125 R126 K127 L128 L129 S130 H131 K133 K134 P135 F136 S137 H139 K142 T157 G158 R159 H160 R161 L175 L182 L184 R186 P188 R190 R191 H193 K195 F220 K222 K223 R226 Y243 I245 R249 K250 Q253 K265 P268 Q269 Q271 R275 S276 N282	G2 H5 C6 S7 R8 N9 R14 R18 S20 R21 S22 M24 Y25 S26 R27 K28 A29 Y31 K32 R33 Y35 A37 A39 T40 K43 P44 V45 G46 R50 K53 K56 M57 P58 R59 Y60 V66 P67 R68 K69 L70 L71 S72 H73 K75 K76 P77 F78 S79 H81 K84 T99 G100 R101 H102 R103 L117 L124 L126 R128 P130 R132 R133 H135 K137 F162 K164 K165 R168 Y175 I177 R181 K182 Q185 K197 P200 Q201 Q203 R207 S208 N214

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rjb, PDBe:8rjb, PDBj:8rjb
PDBsum	8rjb
PubMed	38896445
UniProt	G1SKF7\|RL6_RABIT Large ribosomal subunit protein eL6 (Gene Name=RPL6)

[Back to BioLiP]