Structure of PDB 8rc0 Chain E

Receptor sequence

>8rc0E (length=60) Species: 9606 (Homo sapiens) [Search protein sequence]

EKDDEEADAIYAALDKRMDERRKERREQREKEEKIQQQFSDLKRKLAEVT
EEEWLSIPEV

3D structure

PDB

8rc0 Structure of the human 20S U5 snRNP.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	R116 R119 R120 R123	R22 R25 R26 R29

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0030674	protein-macromolecule adaptor activity
GO:0042802	identical protein binding
GO:0043021	ribonucleoprotein complex binding

	Biological Process
GO:0000244	spliceosomal tri-snRNP complex assembly
GO:0000245	spliceosomal complex assembly
GO:0000375	RNA splicing, via transesterification reactions
GO:0000398	mRNA splicing, via spliceosome
GO:0006396	RNA processing
GO:0006397	mRNA processing
GO:0006403	RNA localization
GO:0008380	RNA splicing
GO:0045944	positive regulation of transcription by RNA polymerase II

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005682	U5 snRNP
GO:0016020	membrane
GO:0016607	nuclear speck
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071005	U2-type precatalytic spliceosome
GO:0071013	catalytic step 2 spliceosome

External links

PDB	RCSB:8rc0, PDBe:8rc0, PDBj:8rc0
PDBsum	8rc0
PubMed	38467877
UniProt	O94906\|PRP6_HUMAN Pre-mRNA-processing factor 6 (Gene Name=PRPF6)