Structure of PDB 8r55 Chain E

Receptor sequence

>8r55E (length=164) Species: 1423 (Bacillus subtilis) [Search protein sequence]

RIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGK
AQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEG
TGVIAGGPVRAVLELAGVADILSKSLGSNTPINMIRATLQGLSELKRAED
VAKLRGKSVEELLG

3D structure

PDB

8r55 B. subtilis MutS2 splits stalled ribosomes into subunits without mRNA cleavage.

Chain

Resolution

3.57 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	V21 A22 K23 V24 V25 K26 G27 R32 K52 Q54 R61 K62 R88 G90 A91 K97 S100 I106 A107 G108 R112 S125 K126 S127 L128 S130 T132 I134 N135 R138	V19 A20 K21 V22 V23 K24 G25 R30 K50 Q52 R59 K60 R86 G88 A89 K95 S98 I104 A105 G106 R110 S123 K124 S125 L126 S128 T130 I132 N133 R136
BS02	rna	E	R20 R29 F31 F33 V56	R18 R27 F29 F31 V54

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8r55, PDBe:8r55, PDBj:8r55
PDBsum	8r55
PubMed	38177497
UniProt	A0A1A0G5K9

[Back to BioLiP]