Structure of PDB 8qrl Chain E

Receptor sequence
>8qrlE (length=118) Species: 9606 (Homo sapiens) [Search protein sequence]
PRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRI
SAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQE
LKECEGIVPVPLAEKLYS
3D structure
PDB8qrl GTPBP8 plays a role in mitoribosome formation in human mitochondria.
ChainE
Resolution3.34 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna E Y4 Y49 R50 S52 Q57 T72 V75 R90 I93 V94 K95 Y3 Y48 R49 S51 Q56 T71 V74 R89 I92 V93 K94
BS02 FES E C105 I108 C104 I107
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qrl, PDBe:8qrl, PDBj:8qrl
PDBsum8qrl
PubMed38969660
UniProtP82932|RT06_HUMAN Small ribosomal subunit protein bS6m (Gene Name=MRPS6)

[Back to BioLiP]