Structure of PDB 8qpp Chain E

Receptor sequence

>8qppE (length=164) Species: 1423 (Bacillus subtilis) [Search protein sequence]

RIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGK
AQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEG
TGVIAGGPVRAVLELAGVADILSKSLGSNTPINMIRATLQGLSELKRAED
VAKLRGKSVEELLG

3D structure

PDB

8qpp An evolutionarily conserved strategy for ribosome binding and inhibition by beta-coronavirus non-structural protein 1

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	V21 A22 K23 V24 V25 K26 R29 K52 Q54 K62 G90 L95 K97 A99 S100 A107 G108 R112 L124 S125 K126 S127 L128 S130 T132 I134 N135 R138	V19 A20 K21 V22 V23 K24 R27 K50 Q52 K60 G88 L93 K95 A97 S98 A105 G106 R110 L122 S123 K124 S125 L126 S128 T130 I132 N133 R136

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8qpp, PDBe:8qpp, PDBj:8qpp
PDBsum	8qpp
PubMed	38177497
UniProt	A0A1A0G5K9

[Back to BioLiP]