Structure of PDB 8p09 Chain E

Receptor sequence

>8p09E (length=226) Species: 9986 (Oryctolagus cuniculus)

GKAEDKEWLPVTKLGRLVKDVKIKSLEEIYLFSLPIKESEIIDFFLGAAL
KDEVLKIMPVQKQTRAAQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIR
GAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVHLIPAPRGT
GIVSAPVPKKLLLMAGIDDCYTSAWSCTATLGNFAKATFDAISKTYSYLT
PDLWKETVFTKSPYQEFTDHLVKTHT

3D structure

• PDB: 8p09 N 6 -methyladenosine in 5' UTR does not promote translation initiation.
• Chain: E
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	M87 V89 Q90 K91 Q92 R94 R98 T162 R164 G166 S167 L169 H171 S183 A184 Y200 T201 W204 S205 T207 N212 K215	M58 V60 Q61 K62 Q63 R65 R69 T133 R135 G137 S138 L140 H142 S154 A155 Y171 T172 W175 S176 T178 N183 K186

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 02:24:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8p09', asym_id = 'E', title = "N 6 -methyladenosine in 5' UTR does not promote translation initiation. "

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8p09', asym_id='E', title="N 6 -methyladenosine in 5' UTR does not promote translation initiation. ")

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015935', uniprot = '', pdbid = '8p09', asym_id = 'E'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015935', uniprot='', pdbid='8p09', asym_id='E')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>