Structure of PDB 8ott Chain E

Receptor sequence
>8ottE (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
3D structure
PDB8ott Cooperation between bHLH transcription factors and histones for DNA access.
ChainE
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R40 Y41 G44 V46 R49 R52 K56 R63 K64 L65 P66 R69 R2 Y3 G6 V8 R11 R14 K18 R25 K26 L27 P28 R31
BS02 dna E R42 T45 R72 R83 F84 Q85 S86 R116 V117 T118 R4 T7 R34 R45 F46 Q47 S48 R78 V79 T80
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8ott, PDBe:8ott, PDBj:8ott
PDBsum8ott
PubMed37407816
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]