Structure of PDB 8jbl Chain E

Receptor sequence
>8jblE (length=33) Species: 9823 (Sus scrofa) [Search protein sequence]
VDPFYYDYETVRNGGLIFAALAFIVGLIIILSK
3D structure
PDB8jbl Crystal structures of Na + ,K + -ATPase reveal the mechanism that converts the K + -bound form to Na + -bound form and opens and closes the cytoplasmic gate.
ChainE
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLR E G29 G30 F33 G14 G15 F18
BS02 DMU E Y21 D22 V26 F33 Y6 D7 V11 F18
Gene Ontology
Molecular Function
GO:0001671 ATPase activator activity
GO:0005515 protein binding
GO:0030674 protein-macromolecule adaptor activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0006811 monoatomic ion transport
GO:0006883 intracellular sodium ion homeostasis
GO:0010248 establishment or maintenance of transmembrane electrochemical gradient
GO:0030007 intracellular potassium ion homeostasis
GO:0036376 sodium ion export across plasma membrane
GO:0043269 regulation of monoatomic ion transport
GO:0055085 transmembrane transport
GO:1902600 proton transmembrane transport
GO:1903408 positive regulation of P-type sodium:potassium-exchanging transporter activity
GO:1990573 potassium ion import across plasma membrane
Cellular Component
GO:0005890 sodium:potassium-exchanging ATPase complex
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jbl, PDBe:8jbl, PDBj:8jbl
PDBsum8jbl
PubMed37357620
UniProtQ58K79

[Back to BioLiP]