Structure of PDB 8ie3 Chain E

Receptor sequence
>8ie3E (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
KSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKS
EIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIR
3D structure
PDB8ie3 Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
ChainE
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna E L29 G30 Y31 K32 Q33 K36 S58 Y88 Y89 R90 V91 L21 G22 Y23 K24 Q25 K28 S50 Y80 Y81 R82 V83
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0031640 killing of cells of another organism
GO:0050829 defense response to Gram-negative bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ie3, PDBe:8ie3, PDBj:8ie3
PDBsum8ie3
PubMed37491604
UniProtP62888|RL30_HUMAN Large ribosomal subunit protein eL30 (Gene Name=RPL30)

[Back to BioLiP]