Structure of PDB 8i7j Chain E

Receptor sequence

>8i7jE (length=260) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

ARGPKKHLKRLAAPHHWMLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNR
LKYALNGREVKAILMQRHVKVDGKVRTDTTFPAGFMDVITLEATNENFRL
VYDVKGRFAVHRITDEEASYKLAKVKKVQLGKKGIPYVVTHDGRTIRYPD
PNIKVNDTVKVDLATGTITDFIKFDTGKLVYVTGGRNLGRVGTIVHRERH
EGGFDLVHIKDSLENTFVTRLNNVFVIGEPGRPWISLPKGKGIKLTISEE
RDRRRAQHGL

3D structure

• PDB: 8i7j Yeast eukaryotic initiation factor 4B remodels the mRNA entry site on the small ribosomal subunit
• Chain: E
• Resolution: 4.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	A2 R3 K6 K7 H8 K10 L12 A13 H16 M19 D21 K22 L23 Y27 P29 A33 G34 P35 H36 K37 L38 R49 N57 G58 M66 K75 R77 T81 K106 Q130 L131 G132 K133 K134 G135 V140 H142 G144 R145 T146 K155 G185 G186 R187 R221 R255	A1 R2 K5 K6 H7 K9 L11 A12 H15 M18 D20 K21 L22 Y26 P28 A32 G33 P34 H35 K36 L37 R48 N56 G57 M65 K74 R76 T80 K105 Q129 L130 G131 K132 K133 G134 V139 H141 G143 R144 T145 K154 G184 G185 R186 R220 R254

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8i7j, PDBe:8i7j, PDBj:8i7j
• PDBsum: 8i7j
• UniProt: Q6CWJ2