Structure of PDB 8hy0 Chain E

Receptor sequence
>8hy0E (length=116) Species: 8355 (Xenopus laevis) [Search protein sequence]
ARTKQTARKSTGGKAPRKQPHRYRPGTVALREIRRYQKSTELLIRKLPFQ
RLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVT
IMPKDIQLARRIRGER
3D structure
PDB8hy0 Structure of histone deacetylase complex Rpd3S bound to nucleosome
ChainE
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H39 R40 Y41 R42 T45 R63 R72 R83 S86 R116 V117 T118 H21 R22 Y23 R24 T27 R45 R54 R65 S68 R98 V99 T100
BS02 dna E R40 P43 G44 V46 A47 K56 R63 K64 L65 P66 R69 R22 P25 G26 V28 A29 K38 R45 K46 L47 P48 R51
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8hy0, PDBe:8hy0, PDBj:8hy0
PDBsum8hy0
PubMed37798513
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]