Structure of PDB 8hr1 Chain E

Receptor sequence
>8hr1E (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEASEAYLVGLFEDTNLSAIHAKRVTIMPKDIQLARRIRGE
3D structure
PDB8hr1 A Cryptic Basic Groove formed by Ubiquitin and Histone H3 Mediates Selective Recognition of H2AK119Ub Nucleosomes by Synovial Sarcoma X Breakpoint 1 Protein.
ChainE
Resolution3.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E Y41 R42 T45 R72 R83 F84 R116 V117 T118 M120 Y3 R4 T7 R34 R45 F46 R78 V79 T80 M82
BS02 dna E H39 R40 Y41 P43 G44 V46 R49 R63 K64 L65 R69 H1 R2 Y3 P5 G6 V8 R11 R25 K26 L27 R31
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8hr1, PDBe:8hr1, PDBj:8hr1
PDBsum8hr1
PubMed38177667
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]