Structure of PDB 8h0i Chain E |
>8h0iE (length=128) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
MENRWQVMIVWQVDRMRINTWKRLVKHHMYISRKAKDWFYRHHYESTNPK ISSEVHIPLGDAKLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDP DLADQLIHLHYFPPLPSVRKLTEDRWNK |
|
PDB | 8h0i Structural insights into RNA bridging between HIV-1 Vif and antiviral factor APOBEC3G. |
Chain | E |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
E |
R23 Y30 H43 |
R23 Y30 H43 |
|
|
|
|