Structure of PDB 8grm Chain E

Receptor sequence
>8grmE (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB8grm Synthetic E2-Ub-nucleosome conjugates for studying nucleosome ubiquitination.
ChainE
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R40 Y41 P43 G44 V46 R49 R63 K64 L65 R69 R83 R3 Y4 P6 G7 V9 R12 R26 K27 L28 R32 R46
BS02 dna E Y41 R42 T45 R63 R72 R83 F84 R116 V117 T118 Y4 R5 T8 R26 R35 R46 F47 R79 V80 T81
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8grm, PDBe:8grm, PDBj:8grm
PDBsum8grm
PubMed
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]