Structure of PDB 8g6s Chain E |
>8g6sE (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] |
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA VMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
|
PDB | 8g6s Ubiquitinated H2B as gatekeeper of the nucleosome acidic patch |
Chain | E |
Resolution | 3.47 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
E |
R42 R63 R72 T118 |
R4 R25 R34 T80 |
|
|
|
|