Structure of PDB 8f86 Chain E

Receptor sequence
>8f86E (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB8f86 Structural Basis of Sirtuin 6-Catalyzed Nucleosome Deacetylation.
ChainE
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R40 Y41 R42 T45 R72 R83 Q85 R116 T118 M120 R1 Y2 R3 T6 R33 R44 Q46 R77 T79 M81
BS02 dna E R40 G44 V46 R49 R63 P66 R1 G5 V7 R10 R24 P27
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8f86, PDBe:8f86, PDBj:8f86
PDBsum8f86
PubMed36930461
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]