Structure of PDB 8evp Chain E

Receptor sequence
>8evpE (length=217) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS
GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI
KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD
VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMSVNFFVSLLKKNWQN
VGSLVVKSSMGPAFRLY
3D structure
PDB8evp Regulation of translation by ribosomal RNA pseudouridylation.
ChainE
Resolution2.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna E R26 N27 E33 Q35 R60 K98 K101 K102 K105 N108 K130 C164 V205 K207 M210 A213 R215 R26 N27 E33 Q35 R60 K98 K101 K102 K105 N108 K130 C164 V205 K207 M210 A213 R215
BS02 rna E K118 P121 R122 P126 Q127 S129 K130 K161 K118 P121 R122 P126 Q127 S129 K130 K161
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Dec 2 07:18:43 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8evp', asym_id = 'E', title = 'Regulation of translation by ribosomal RNA pseudouridylation.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8evp', asym_id='E', title='Regulation of translation by ribosomal RNA pseudouridylation.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003735,0006412,0015934', uniprot = '', pdbid = '8evp', asym_id = 'E'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015934', uniprot='', pdbid='8evp', asym_id='E')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>