Structure of PDB 8etj Chain E

Receptor sequence

>8etjE (length=165) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

YRENVPKKARKAVRPTKLRASLAPGTVCILLAGRFRGKRVVVLSQLEDTL
VVTGPYKVNGVPIRRVNHRYVIATSAPKIDVSGVSVEKFTKAYFAKQKRS
GPVKKDEAFFAENAPKNALPAERIADQKAVDAKLLPAIKAIPNMKEYLAA
SFALSNGDRPHLMKF

3D structure

PDB

8etj Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	N34 V35 K37 R40 K41 A42 R44 T46 K47 G63 R64 D78 T79 Y86 N89 G90 P92 R94 R95 N97 H98 R99 Y100 K121 K126 P132 A144 P145 A148 P150 R153 I154 E176 A180 S181 S185 N186	N4 V5 K7 R10 K11 A12 R14 T16 K17 G33 R34 D48 T49 Y56 N59 G60 P62 R64 R65 N67 H68 R69 Y70 K91 K96 P102 A114 P115 A118 P120 R123 I124 E146 A150 S151 S155 N156

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8etj, PDBe:8etj, PDBj:8etj
PDBsum	8etj
PubMed	36423630
UniProt	P79071\|RL6_SCHPO Large ribosomal subunit protein eL6 (Gene Name=rpl6)

[Back to BioLiP]