Structure of PDB 8el6 Chain E

Receptor sequence

>8el6E (length=61) Species: 464988 (Hemiselmis andersenii)

MKKDSKAPCVEVFDERDGCKAAGTQKASGDDGFCVKVSMKAIKMNAAEAT
SVTKNYNTKLL

3D structure

• PDB: 8el6 Molecular dissection of the soluble photosynthetic antenna from the cryptophyte alga Hemiselmis andersenii
• Chain: E
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	E	F14 E16 C20 A22 T25 Q26 K27 A28 G33 C35 K37	F13 E15 C19 A21 T24 Q25 K26 A27 G32 C34 K36
BS02	AX9	E	Y57 K60 L61	Y56 K59 L60
BS03	PEB	E	M2 K4 S6	M1 K3 S5
BS04	PEB	E	V13 F34	V12 F33
BS05	PEB	E	M45 A47	M44 A46
BS06	PEB	E	F14 E16 C20 A22 T25 Q26 K27 A28 G33 C35 K37	F13 E15 C19 A21 T24 Q25 K26 A27 G32 C34 K36
BS07	PEB	E	M45 A47	M44 A46

Gene Ontology

Cellular Component

• GO:0030089 phycobilisome

External links

• PDB: RCSB:8el6, PDBe:8el6, PDBj:8el6
• PDBsum: 8el6
• PubMed: 37957226
• UniProt: U5TBJ3|PHEA2_HEMAN Phycoerythrin alpha-2 subunit (Gene Name=HAND1043_LOCUS7931)