Structure of PDB 8el3 Chain E

Receptor sequence

>8el3E (length=62) Species: 464988 (Hemiselmis andersenii)

AMKKDSKAPCVEVFDERDGCKAAGTQKASGDDGFCVKVSMKAIKMNAAEA
TSVTKNYNTKLL

3D structure

• PDB: 8el3 Molecular dissection of the soluble photosynthetic antenna from the cryptophyte alga Hemiselmis andersenii
• Chain: E
• Resolution: 1.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	E	F14 E16 C20 K21 A22 T25 Q26 K27 A28 G33 C35 K37	F14 E16 C20 K21 A22 T25 Q26 K27 A28 G33 C35 K37
BS02	AX9	E	Y57 N58 K60 L61	Y57 N58 K60 L61
BS03	PEB	E	M2 K4 S6	M2 K4 S6
BS04	PEB	E	V13 F14 R17 F34	V13 F14 R17 F34
BS05	PEB	E	K44 M45 A47	K44 M45 A47
BS06	PEB	E	F14 E16 C20 K21 A22 T25 Q26 K27 A28 G33 C35 K37	F14 E16 C20 K21 A22 T25 Q26 K27 A28 G33 C35 K37
BS07	PEB	E	K44 M45 A47	K44 M45 A47

Gene Ontology

Cellular Component

• GO:0030089 phycobilisome

External links

• PDB: RCSB:8el3, PDBe:8el3, PDBj:8el3
• PDBsum: 8el3
• PubMed: 37957226
• UniProt: U5TBJ3|PHEA2_HEMAN Phycoerythrin alpha-2 subunit (Gene Name=HAND1043_LOCUS7931)