Structure of PDB 8dqn Chain E

Receptor sequence

>8dqnE (length=381) Species: 998674 (Leucothrix mucor DSM 2157)

TGLTILRNANVYAPQPLGLKTVLVGGGKILAITDEALELPASIVADDIDL
QGRILTPGFIDAHAHITGGGGEAGFATQVPPVPLSQFTAFGVTTVVGLLG
TDDTTRSTGNLLSRVYGLREEGMSAYCWTGGYHYPLTTLMGSAREDIVYM
EPIIGVGEFAISDHRSSQPQFEEVIRIASDAHVAGLMTGKAGIVHFHLGD
GSRKLALIKRALAETELPARVFNPTHVNRNKPLFDEACEMLSQGIYIDIT
AFPDDAVDDGWSAAEALLLAKERGCPLKQITISSDGGGCMPAFAMDFGRS
ETLLATLKTVTAQGMALEDVLSSLTANVAHLLRLPAKGKIATGADADLLV
LDADYSINDVMALGRWHLRDKALIMKGTFEE

3D structure

• PDB: 8dqn Bioinformatics of cyanophycin metabolism genes and characterization of promiscuous isoaspartyl dipeptidases that catalyze the final step of cyanophycin degradation.
• Chain: E
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	E	E159 H198 H227	E158 H197 H226
BS02	ZN	E	E159 D286	E158 D285

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 10:36:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8dqn', asym_id = 'E', title = 'Bioinformatics of cyanophycin metabolism genes a...alyze the final step of cyanophycin degradation. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8dqn', asym_id='E', title='Bioinformatics of cyanophycin metabolism genes a...alyze the final step of cyanophycin degradation. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0008798,0016787,0016810', uniprot = '', pdbid = '8dqn', asym_id = 'E'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008798,0016787,0016810', uniprot='', pdbid='8dqn', asym_id='E')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>