Structure of PDB 8db4 Chain E |
>8db4E (length=95) Species: 3818 (Arachis hypogaea) [Search protein sequence] |
AARRCQSQLERANLRPCEQHLMQKIQRSQHQERCCNELNEFENNQRCMCE ALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLDV |
|
PDB | 8db4 Immunotherapy-induced neutralizing antibodies disrupt allergen binding and sustain allergen tolerance in peanut allergy. |
Chain | E |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
E |
H48 S85 |
H20 S28 |
|
|
|
|