Structure of PDB 8d8j Chain E

Receptor sequence

>8d8jE (length=168) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

YITRKLTMKPLVMKRVSNQTGKGKIASFYALVVVGDKNGMVGLGEGKSRE
EMSKAIFKAHWDAVRNLKEIPRYENRTIYGDIDFRYHGVKLHLRSAKPGF
GLRVNHVIFEICECAGIKDLSGKVYKSRNDMNIAKGTIEAFTKAQKTLDE
VALGRGKKLVDVRKVYYS

3D structure

PDB

8d8j Principles of mitoribosomal small subunit assembly in eukaryotes.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	K152 V154 S155 N156 Q157 G159 K162 R223 H225 G226 K228 H230 R232 A234 K235 F238 R241 V242 N243 H244 G260 K261 Y263 K264 S265 R266 N267 N270 K302 Y304 Y305	K14 V16 S17 N18 Q19 G21 K24 R85 H87 G88 K90 H92 R94 A96 K97 F100 R103 V104 N105 H106 G122 K123 Y125 K126 S127 R128 N129 N132 K164 Y166 Y167

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8d8j, PDBe:8d8j, PDBj:8d8j
PDBsum	8d8j
PubMed	36482135
UniProt	P33759\|RT05_YEAST Small ribosomal subunit protein uS5m (Gene Name=MRPS5)

[Back to BioLiP]