Structure of PDB 8d3q Chain E

Receptor sequence
>8d3qE (length=98) Species: 272558 (Halalkalibacterium halodurans C-125) [Search protein sequence]
GSMLVLITYDVQTSSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQL
TSLKLELTSLIDEEKDSLRIYRLGNNYKTKVEHIGAKPSIDLEDPLIF
3D structure
PDB8d3q PAM binding ensures orientational integration during Cas4-Cas1-Cas2-mediated CRISPR adaptation.
ChainE
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E Y7 D8 V9 Q10 S12 N36 S37 Y9 D10 V11 Q12 S14 N38 S39
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8d3q, PDBe:8d3q, PDBj:8d3q
PDBsum8d3q
PubMed36272411
UniProtQ9KFX8|CAS2_HALH5 CRISPR-associated endonuclease Cas2 (Gene Name=cas2)

[Back to BioLiP]