Structure of PDB 8c93 Chain E

Receptor sequence
>8c93E (length=186) Species: 562 (Escherichia coli) [Search protein sequence]
MELVLKDAQSALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRAQKTRA
EVTGSGSIKSPIWRSGGVTFAARPQDHSQKVNKKMYRGALKSILSELVRQ
DRLIVVEKFSVEAPKTKLLAQKLKDMALEDVLIITGELDENLFLAARNLH
KVDVRDATGIDPVSLIAFDKVVMTADAVKQVEEMLA
3D structure
PDB8c93 Cryo-EM captures early ribosome assembly in action.
ChainE
Resolution4.17 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0001070 RNA-binding transcription regulator activity
GO:0003677 DNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0030371 translation repressor activity
GO:0048027 mRNA 5'-UTR binding
GO:0060698 endoribonuclease inhibitor activity
Biological Process
GO:0002181 cytoplasmic translation
GO:0006353 DNA-templated transcription termination
GO:0006412 translation
GO:0006417 regulation of translation
GO:0017148 negative regulation of translation
GO:0031555 transcriptional attenuation
GO:0042255 ribosome assembly
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
GO:2000766 negative regulation of cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8c93, PDBe:8c93, PDBj:8c93
PDBsum8c93
PubMed36797249
UniProtP60723|RL4_ECOLI Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]