Structure of PDB 8c29 Chain E

Receptor sequence
>8c29E (length=65) Species: 3329 (Picea abies) [Search protein sequence]
YWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQEVPLVTG
RFDSLEQLDEFTRSF
3D structure
PDB8c29 Cryo-EM structure of a plant photosystem II supercomplex with light-harvesting protein Lhcb8 and alpha-tocopherol.
ChainE
Resolution2.785 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide E T67 G68 R69 D71 T49 G50 R51 D53
BS02 HEM E Y19 H23 I27 Y1 H5 I9
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c29, PDBe:8c29, PDBj:8c29
PDBsum8c29
PubMed37550369
UniProtR4ZGW6

[Back to BioLiP]