Structure of PDB 8b6c Chain E

Receptor sequence

>8b6cE (length=216) Species: 9986 (Oryctolagus cuniculus)

KGKPHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYAALATVTKPVGGGTR
VVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTG
RHRGKRVVFLKQLSSGLLLVTGPLSLNRVPLRRTHQKFVIATSTKIDISG
VKIPKHLTDAYFKKKKKYEITEQRKVDQKAVDSQILPKIKAVPQLQGYLR
SVFALTNGVYPHKLVF

3D structure

• PDB: 8b6c Structural insights into TRAP association with ribosome-Sec61 complex and translocon inhibition by a CADA derivative.
• Chain: E
• Resolution: 2.79 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	K41 H45 C46 S47 R48 R54 S60 R61 S62 M64 Y65 S66 R67 Y71 K72 R73 K74 Y75 A77 A93 T94 K97 P98 V99 G100 R108 V110 K111 R113 K114 M115 P116 R117 R126 K127 L128 L129 H131 K133 P135 F136 S137 H139 T157 R159 H160 R161 L175 L182 L184 R186 P188 R190 R191 H193 K195 F220 K222 Y243 I245 R249 K250 K265 P268 Q269 Q271 R275 S276 V277 N282	K1 H5 C6 S7 R8 R14 S20 R21 S22 M24 Y25 S26 R27 Y31 K32 R33 K34 Y35 A37 A39 T40 K43 P44 V45 G46 R50 V52 K53 R55 K56 M57 P58 R59 R68 K69 L70 L71 H73 K75 P77 F78 S79 H81 T99 R101 H102 R103 L117 L124 L126 R128 P130 R132 R133 H135 K137 F162 K164 Y168 I170 R174 K175 K190 P193 Q194 Q196 R200 S201 V202 N207

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005791 rough endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8b6c, PDBe:8b6c, PDBj:8b6c
• PDBsum: 8b6c
• PubMed: 36867692
• UniProt: G1SKF7|RL6_RABIT Large ribosomal subunit protein eL6 (Gene Name=RPL6)