Structure of PDB 8asl Chain E

Receptor sequence

>8aslE (length=44) Species: 1148 (Synechocystis sp. PCC 6803)

IVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDAFGTPRPDEYF

3D structure

• PDB: 8asl The Ycf48 accessory factor occupies the site of the oxygen-evolving manganese cluster during photosystem II biogenesis.
• Chain: E
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	L30 F31 G34 W35 V38	L18 F19 G22 W23 V26
BS02	HEM	E	Y19 I22 H23 T26 I27	Y7 I10 H11 T14 I15

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0005737 cytoplasm
• GO:0009523 photosystem II
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030096 plasma membrane-derived thylakoid photosystem II
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:8asl, PDBe:8asl, PDBj:8asl
• PDBsum: 8asl
• PubMed: 37542031
• UniProt: P09190|PSBE_SYNY3 Cytochrome b559 subunit alpha (Gene Name=psbE)