Structure of PDB 8am5 Chain E

Receptor sequence

>8am5E (length=37) Species: 1148 (Synechocystis sp. PCC 6803)

WVIHSITIPMLFIAGWLFVSTGLAYDAFGTPRPDEYF

3D structure

• PDB: 8am5 The Ycf48 accessory factor occupies the site of the oxygen-evolving manganese cluster during photosystem II biogenesis.
• Chain: E
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	L30 F31 W35 V38	L11 F12 W16 V19
BS02	HEM	E	I22 H23 T26 I27	I3 H4 T7 I8

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0005737 cytoplasm
• GO:0009523 photosystem II
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030096 plasma membrane-derived thylakoid photosystem II
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:8am5, PDBe:8am5, PDBj:8am5
• PDBsum: 8am5
• PubMed: 37542031
• UniProt: P09190|PSBE_SYNY3 Cytochrome b559 subunit alpha (Gene Name=psbE)