Structure of PDB 8agu Chain E

Receptor sequence

>8aguE (length=156) Species: 4932 (Saccharomyces cerevisiae)

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRV
LRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQR
EKALNE

3D structure

• PDB: 8agu Molecular basis of eIF5A-dependent CAT tailing in eukaryotic ribosome-associated quality control.
• Chain: E
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	A2 N3 R5 T6 K8 R9 G18 K19 R20 K21 W23 L24 P26 S37 R38 R42 K43 K46 T56 H58 S59 K60 S61 R62 R64 R74 H75 G77 Y78 G79 K80 R81 K82 G83 T84 R85 A87 R88 L89 P90 Q92 W95 I96 L99 R100 R103 R104 R110 K114 H118 Y120 H121 Y124 K125 K128 G129 K135 R136 I143	A1 N2 R4 T5 K7 R8 G17 K18 R19 K20 W22 L23 P25 S36 R37 R41 K42 K45 T55 H57 S58 K59 S60 R61 R63 R73 H74 G76 Y77 G78 K79 R80 K81 G82 T83 R84 A86 R87 L88 P89 Q91 W94 I95 L98 R99 R102 R103 R109 K113 H117 Y119 H120 Y123 K124 K127 G128 K134 R135 I142

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8agu, PDBe:8agu, PDBj:8agu
• PDBsum: 8agu
• PubMed: 36804914
• UniProt: P0CX82|RL19A_YEAST Large ribosomal subunit protein eL19A (Gene Name=RPL19A)