Structure of PDB 7ze3 Chain E

Receptor sequence
>7ze3E (length=48) Species: 1076 (Rhodopseudomonas palustris) [Search protein sequence]
MNQGRIWTVVKPTVGLPLLLGSVAIMVFLVHFAVLTHTTWVAKFMNGK
3D structure
PDB7ze3 Cryo-EM structures of light-harvesting 2 complexes from Rhodopseudomonas palustris reveal the molecular origin of absorption tuning.
ChainE
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZE0 E F28 H31 F32 F28 H31 F32
BS02 ZE0 E M26 A33 M26 A33
BS03 BCL E M1 Q3 M1 Q3
BS04 BCL E H31 W40 H31 W40
BS05 ZE0 E Q3 R5 I6 Q3 R5 I6
BS06 BCL E V27 V30 H31 V27 V30 H31
BS07 BCL E W7 V10 S22 W7 V10 S22
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ze3, PDBe:7ze3, PDBj:7ze3
PDBsum7ze3
PubMed36251992
UniProtP35104|LHA4_RHOPA Light-harvesting protein B-800-850 alpha chain D (Gene Name=pucAD)

[Back to BioLiP]