Structure of PDB 7ywx Chain E

Receptor sequence
>7ywxE (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
GWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQ
EAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGL
3D structure
PDB7ywx Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
ChainE
Resolution12.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna E R63 R69 R18 R24
BS02 dna E R72 N85 Q87 R118 V119 T120 R27 N40 Q42 R73 V74 T75
BS03 peptide E Q127 R130 R131 L135 Q82 R85 R86 L90
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000132 establishment of mitotic spindle orientation
GO:0000281 mitotic cytokinesis
GO:0034080 CENP-A containing chromatin assembly
GO:0051301 cell division
GO:0051382 kinetochore assembly
GO:0061644 protein localization to CENP-A containing chromatin
GO:0071459 protein localization to chromosome, centromeric region
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000779 condensed chromosome, centromeric region
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005721 pericentric heterochromatin
GO:0005829 cytosol
GO:0043505 CENP-A containing nucleosome
GO:0061638 CENP-A containing chromatin

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ywx, PDBe:7ywx, PDBj:7ywx
PDBsum7ywx
PubMed35420891
UniProtP49450|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA)

[Back to BioLiP]