Structure of PDB 7yml Chain E

Receptor sequence
>7ymlE (length=44) Species: 1061 (Rhodobacter capsulatus) [Search protein sequence]
DLSFTGLTDEQAQELHAVYMSGLSAFIAVAVLAHLAVMIWRPWF
3D structure
PDB7yml Rhodobacter capsulatus forms a compact crescent-shaped LH1-RC photocomplex.
ChainE
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL E F30 V33 A34 A37 H38 F26 V29 A30 A33 H34
BS02 SPO E L19 V22 G26 L27 F30 L15 V18 G22 L23 F26
BS03 SPO E A37 A40 W44 A33 A36 W40
BS04 BCL E F30 I31 A34 V35 H38 V41 W47 F48 F26 I27 A30 V31 H34 V37 W43 F44
BS05 BCL E Y23 F48 Y19 F44
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yml, PDBe:7yml, PDBj:7yml
PDBsum7yml
PubMed36792596
UniProtP02950|LHB1_RHOCA Light-harvesting protein B-870 beta chain (Gene Name=pufB)

[Back to BioLiP]