Structure of PDB 7xyf Chain E

Receptor sequence
>7xyfE (length=98) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB7xyf Cryo-EM structure of Fft3-nucleosome complex with Fft3 bound to SHL+2 position of the nucleosome (Class I Fft3-nucleosome complex)
ChainE
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R42 R72 R83 F84 S86 R116 V117 T118 M120 R5 R35 R46 F47 S49 R79 V80 T81 M83
BS02 dna E R40 P43 G44 V46 A47 R63 K64 L65 P66 R69 R83 R3 P6 G7 V9 A10 R26 K27 L28 P29 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7xyf, PDBe:7xyf, PDBj:7xyf
PDBsum7xyf
PubMed
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]