Structure of PDB 7xt7 Chain E

Receptor sequence

>7xt7E (length=213) Species: 460519 (Komagataella phaffii) [Search protein sequence]

EDNNRIISRLWRSFRTVKEMAADRGYFISQEEMDQSLEEFRSKICDSMGN
PQRKLMSFLANPTPEALEKYSDLGTLWVEFCDEPSVGIKTMRNFCLRIQE
KNFSTGIFIYQNNITPSANKMIPTVSPAIIETFQESDLVVNITHHELVPK
HIRLSDGEKSQLLQRYKLKESQLPRIQREDPVARYLGLKRGQVVKIIRRS
ETSGRYASYRICL

3D structure

PDB

7xt7 Structural basis of nucleosome disassembly and reassembly by RNAPII elongation complex with FACT.

Chain

Resolution

4.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	E	I89 S118	I88 S117

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0001055	RNA polymerase II activity
GO:0001056	RNA polymerase III activity
GO:0003677	DNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0003968	RNA-dependent RNA polymerase activity

	Biological Process
GO:0001172	RNA-templated transcription
GO:0006351	DNA-templated transcription
GO:0006360	transcription by RNA polymerase I
GO:0006361	transcription initiation at RNA polymerase I promoter
GO:0006362	transcription elongation by RNA polymerase I
GO:0006363	termination of RNA polymerase I transcription
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0006368	transcription elongation by RNA polymerase II
GO:0006383	transcription by RNA polymerase III
GO:0006384	transcription initiation at RNA polymerase III promoter
GO:0006386	termination of RNA polymerase III transcription
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
GO:0042797	tRNA transcription by RNA polymerase III

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005666	RNA polymerase III complex
GO:0005736	RNA polymerase I complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7xt7, PDBe:7xt7, PDBj:7xt7
PDBsum	7xt7
PubMed	35981082
UniProt	C4R3P8

[Back to BioLiP]