Structure of PDB 7xd1 Chain E

Receptor sequence
>7xd1E (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB7xd1 H2B Lys34 Ubiquitination Induces Nucleosome Distortion to Stimulate Dot1L Activity.
ChainE
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R40 Y41 P43 G44 V46 R49 R63 K64 L65 P66 R69 R3 Y4 P6 G7 V9 R12 R26 K27 L28 P29 R32
BS02 dna E R42 T45 R72 R83 F84 R116 T118 R5 T8 R35 R46 F47 R79 T81
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7xd1, PDBe:7xd1, PDBj:7xd1
PDBsum7xd1
PubMed35739357
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]