Structure of PDB 7xcr Chain E

Receptor sequence
>7xcrE (length=98) Species: 32630 (synthetic construct) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB7xcr H2B Lys34 Ubiquitination Induces Nucleosome Distortion to Stimulate Dot1L Activity.
ChainE
Resolution2.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R42 T45 R72 R83 Q85 S86 R116 V117 T118 R5 T8 R35 R46 Q48 S49 R79 V80 T81
BS02 dna E R40 Y41 G44 V46 R49 R63 K64 L65 P66 R3 Y4 G7 V9 R12 R26 K27 L28 P29
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7xcr, PDBe:7xcr, PDBj:7xcr
PDBsum7xcr
PubMed35739357
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]