Structure of PDB 7xbk Chain E

Receptor sequence

>7xbkE (length=348) Species: 9606 (Homo sapiens)

EAERRRFPLEQRLKEHIIGQESAIATVGAAIRRKENGWYDEEHPLVFLFL
GSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGY
VGHEEGGQLTKKLKQCPNAVVLFDQVDKAHPDVLTIMLQLFDEGRLTDGK
GKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQI
SDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLV
NKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKHEVERRV
VNQLAAAYEQDLLPGGCTLRITVEDSDKQLLPKLRLEIIDKDSKTRRL

3D structure

• PDB: 7xbk Comprehensive structural characterization of the human AAA+ disaggregase CLPB in the apo- and substrate-bound states reveals a unique mode of action driven by oligomerization.
• Chain: E
• Resolution: 3.7 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	G399 Y400 V401	G99 Y100 V101
BS02	ATP	E	I317 I318 G354 I355 G356 K357 T358 E359 F541 R590	I17 I18 G54 I55 G56 K57 T58 E59 F241 R290

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0140545 ATP-dependent protein disaggregase activity

Biological Process

• GO:0030851 granulocyte differentiation
• GO:0034605 cellular response to heat
• GO:0039529 RIG-I signaling pathway
• GO:0140374 antiviral innate immune response

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:7xbk, PDBe:7xbk, PDBj:7xbk
• PDBsum: 7xbk
• PubMed: 36745679
• UniProt: Q9H078|CLPB_HUMAN Mitochondrial disaggregase (Gene Name=CLPB)