Structure of PDB 7uvw Chain E

Receptor sequence

>7uvwE (length=200) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]

MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRAD
VSGGGKKPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMY
RGAMQCILAELVRQDRLVLVEEFAVAAPKTKELLAKLNDLNAARALIVTD
AVDENLYLAARNLPHVDVVDATAIDPVSLIAFDKVVMSVAAAKKIEVELG

3D structure

PDB

7uvw Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.

Chain

Resolution

2.37 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	N23 H28 Q29 Y34 L35 G38 R39 Q40 T42 R43 H45 K46 R48 A49 V51 G53 K56 Q61 K62 G63 G65 R66 A67 R68 G70 P75 I76 V78 G79 K82 T83 F84 K94 N96 R97 K98 M99 Y100 R101 P128 K131 L158 R161 N162 H165	N23 H28 Q29 Y34 L35 G38 R39 Q40 T42 R43 H45 K46 R48 A49 V51 G53 K56 Q61 K62 G63 G65 R66 A67 R68 G70 P75 I76 V78 G79 K82 T83 F84 K94 N96 R97 K98 M99 Y100 R101 P128 K131 L158 R161 N162 H165

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7uvw, PDBe:7uvw, PDBj:7uvw
PDBsum	7uvw
PubMed	37192172
UniProt	B7IA38\|RL4_ACIB5 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]