Structure of PDB 7ud5 Chain E

Receptor sequence
>7ud5E (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
KALQEASEAYLVALFEDTNLCAIHAKRVTIKPKDIQLARRIRGER
3D structure
PDB7ud5 Multistate structures of the MLL1-WRAD complex bound to H2B-ubiquitinated nucleosome.
ChainE
Resolution4.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R40 P43 V46 R63 K64 L65 R1 P4 V7 R24 K25 L26
BS02 dna E Y41 R72 R83 F84 Q85 R116 T118 Y2 R33 R44 F45 Q46 R77 T79
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7ud5, PDBe:7ud5, PDBj:7ud5
PDBsum7ud5
PubMed36095189
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]