Structure of PDB 7txc Chain E

Receptor sequence
>7txcE (length=84) Species: 9606 (Homo sapiens) [Search protein sequence]
SRPFKCSVCEKTYKDPATLRQHEKTHWLTRPFPCNICGKMFTQRGTMTRH
MRSHLGLKPFACDECGMRFTRQYRLTEHMRVHSG
3D structure
PDB7txc HIC2 controls developmental hemoglobin switching by repressing BCL11A transcription.
ChainE
Resolution3.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E Y514 Q522 R545 R550 Y574 Y13 Q21 R44 R49 Y73
BS02 dna E L529 R531 K540 F542 Q544 T547 R550 H551 K559 T571 R572 R575 L28 R30 K39 F41 Q43 T46 R49 H50 K58 T70 R71 R74
BS03 ZN E C535 C538 H551 H555 C34 C37 H50 H54
BS04 ZN E C507 H523 H527 C6 H22 H26
BS05 ZN E C566 H579 H583 C65 H78 H82
External links
PDB RCSB:7txc, PDBe:7txc, PDBj:7txc
PDBsum7txc
PubMed35941187
UniProtQ96JB3|HIC2_HUMAN Hypermethylated in cancer 2 protein (Gene Name=HIC2)

[Back to BioLiP]