Structure of PDB 7ttw Chain E

Receptor sequence
>7ttwE (length=111) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKV
LMSALANAEHNYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRT
SHITIVVSDGK
3D structure
PDB7ttw A Structurally Characterized Staphylococcus aureus Evolutionary Escape Route from Treatment with the Antibiotic Linezolid.
ChainE
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna E V6 R8 R11 R15 K16 R18 K41 A42 A56 N57 H60 N61 N77 E78 K83 R86 R88 A89 Q90 G91 R92 A93 A95 N97 V6 R8 R11 R15 K16 R18 K41 A42 A56 N57 H60 N61 N77 E78 K83 R86 R88 A89 Q90 G91 R92 A93 A95 N97
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ttw, PDBe:7ttw, PDBj:7ttw
PDBsum7ttw
PubMed35736238
UniProtQ2FW11|RL22_STAA8 Large ribosomal subunit protein uL22 (Gene Name=rplV)

[Back to BioLiP]