Structure of PDB 7t8s Chain E

Receptor sequence

>7t8sE (length=172) Species: 233184 (Cryptomonas pyrenoidifera) [Search protein sequence]

ALDAFSKVAKAAYVGGADLQALKKFISEGNKRLDAVNSIVSNASCIVSDA
VSGMICENPSLISPSGNCYTNRRMAACLRDGEIILRYVSYALLSGDSSVL
EDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQRKLSTPQ
GDCSALASEVAGYFDKVSAAIG

3D structure

PDB

7t8s Molecular structures reveal the origin of spectral variation in cryptophyte light harvesting antenna proteins.

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	E	M60 N73 C74 R78 R79 A82 C83 R85 D86 I89 L121 V123 P124 S127 N128	M54 N67 C68 R72 R73 A76 C77 R79 D80 I83 L115 V117 P118 S121 N122
BS02	KPX	E	K29 N36 K37 L39 D40 A41 V143 T154 P155 G157 C159	K23 N30 K31 L33 D34 A35 V137 T148 P149 G151 C153
BS03	KQ6	E	C51 D55 S58 G59 C62 R130 I134 C138 A141 F142 S148 Q149	C45 D49 S52 G53 C56 R124 I128 C132 A135 F136 S142 Q143
BS04	KQ6	E	Q149 K151	Q143 K145
BS05	KP9	E	S66 I68 S69	S60 I62 S63

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009536	plastid
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7t8s, PDBe:7t8s, PDBj:7t8s
PDBsum	7t8s
PubMed	36721353
UniProt	A0A222AH92

[Back to BioLiP]