Structure of PDB 7t3c Chain E

Receptor sequence
>7t3cE (length=306) Species: 9606 (Homo sapiens) [Search protein sequence]
PRILLMGLRRSGKSSIQKVVFHKMSPNETLALESTNKIYKDDISNSSFVN
FQIWDFPGQMDFFDPTFDYEMIFRGTGALIYVIDAQDDYMEALTRLHITV
SKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKL
HLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFL
FDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYGLKEDGSGSAYD
KESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGLIDYNFHCFRK
AIHEVF
3D structure
PDB7t3c Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.
ChainE
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP E R71 S72 G73 K74 S76 L91 L93 E94 S95 K179 D181 S219 I220 R10 S11 G12 K13 S15 L30 L32 E33 S34 K118 D120 S158 I159
BS02 AF3 E R70 K74 S95 T96 P118 R9 K13 S34 T35 P57
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0043495 protein-membrane adaptor activity
GO:0046982 protein heterodimerization activity
GO:0051020 GTPase binding
GO:0060090 molecular adaptor activity
GO:0140767 enzyme-substrate adaptor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006915 apoptotic process
GO:0007264 small GTPase-mediated signal transduction
GO:0008104 protein localization
GO:0008380 RNA splicing
GO:0009267 cellular response to starvation
GO:0010507 negative regulation of autophagy
GO:0031669 cellular response to nutrient levels
GO:0032006 regulation of TOR signaling
GO:0034198 cellular response to amino acid starvation
GO:0043200 response to amino acid
GO:0061462 protein localization to lysosome
GO:0071230 cellular response to amino acid stimulus
GO:0072657 protein localization to membrane
GO:1903432 regulation of TORC1 signaling
GO:1904263 positive regulation of TORC1 signaling
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle
GO:1990131 Gtr1-Gtr2 GTPase complex
GO:1990877 FNIP-folliculin RagC/D GAP

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7t3c, PDBe:7t3c, PDBj:7t3c
PDBsum7t3c
PubMed35338845
UniProtQ9HB90|RRAGC_HUMAN Ras-related GTP-binding protein C (Gene Name=RRAGC)

[Back to BioLiP]