Structure of PDB 7sss Chain E

Receptor sequence
>7sssE (length=173) Species: 9606 (Homo sapiens) [Search protein sequence]
SRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHL
KKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEES
IAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAP
AYAVLKSIIQAGCRVAIYLSERL
3D structure
PDB7sss Structure and functionality of a multimeric human COQ7:COQ9 complex.
ChainE
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.14.99.60: 3-demethoxyubiquinol 3-hydroxylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 8PP E G59 G62 W115 L118 L122 G125 I203 G206 G15 G18 W71 L74 L78 G81 I159 G162
BS02 NAD E R51 Y212 R216 R7 Y168 R172
Gene Ontology
Molecular Function
GO:0004497 monooxygenase activity
GO:0005515 protein binding
GO:0008682 3-demethoxyubiquinol 3-hydroxylase activity
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0046872 metal ion binding
Biological Process
GO:0006744 ubiquinone biosynthetic process
GO:0008340 determination of adult lifespan
GO:0010468 regulation of gene expression
GO:2000377 regulation of reactive oxygen species metabolic process
Cellular Component
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0031314 extrinsic component of mitochondrial inner membrane
GO:0110142 ubiquinone biosynthesis complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7sss, PDBe:7sss, PDBj:7sss
PDBsum7sss
PubMed36306796
UniProtQ99807|COQ7_HUMAN 5-demethoxyubiquinone hydroxylase, mitochondrial (Gene Name=COQ7)

[Back to BioLiP]