Structure of PDB 7ssa Chain E

Receptor sequence
>7ssaE (length=91) Species: 8355 (Xenopus laevis) [Search protein sequence]
PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMAL
QEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
3D structure
PDB7ssa Basic helix-loop-helix pioneer factors interact with the histone octamer to invade nucleosomes and generate nucleosome-depleted regions.
ChainE
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E G44 V46 A47 R63 K64 L65 R69 R83 G2 V4 A5 R21 K22 L23 R27 R41
BS02 dna E P43 R72 F84 Q85 R116 V117 T118 M120 P1 R30 F42 Q43 R74 V75 T76 M78
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7ssa, PDBe:7ssa, PDBj:7ssa
PDBsum7ssa
PubMed36996811
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]