Structure of PDB 7s8t Chain E |
>7s8tE (length=78) Species: 34 (Myxococcus xanthus) [Search protein sequence] |
TDTELARSIRLNIEAELDAINLYAAHIDATDNEDAKAILQHVMDEEREHA ALFWELIARLDPEQAAHAKEAVEKYRLI |
|
PDB | 7s8t Structural characterization of the Myxococcus xanthus encapsulin and ferritin-like cargo system gives insight into its iron storage mechanism. |
Chain | E |
Resolution | 2.49 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
E |
E38 E68 H71 |
E16 E46 H49 |
|
|
|
|