Structure of PDB 7rwy Chain E

Receptor sequence

>7rwyE (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLED
KSPDSPEMHDFRHGFWILIGQIHAALHLANEGKVKEAQAAAEQLKCTCNA
CHQKYR

3D structure

• PDB: 7rwy Redox- and metal-directed structural diversification in designed metalloprotein assemblies.
• Chain: E
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	E	H73 H77	H73 H77
BS02	HEC	E	M7 F61 G64 F65 C98 C101 H102 R106	M7 F61 G64 F65 C98 C101 H102 R106

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:7rwy, PDBe:7rwy, PDBj:7rwy
• PDBsum: 7rwy
• PubMed: 35642584
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)